Lineage for d1dchh_ (1dch H:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81244Fold d.74: DCoH-like [55247] (4 superfamilies)
  4. 81245Superfamily d.74.1: Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55248] (1 family) (S)
  5. 81246Family d.74.1.1: Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55249] (1 protein)
  6. 81247Protein Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55250] (1 species)
  7. 81248Species Rat (Rattus norvegicus) [TaxId:10116] [55251] (4 PDB entries)
  8. 81276Domain d1dchh_: 1dch H: [39699]

Details for d1dchh_

PDB Entry: 1dch (more details), 3 Å

PDB Description: crystal structure of dcoh, a bifunctional, protein-binding transcription coactivator

SCOP Domain Sequences for d1dchh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dchh_ d.74.1.1 (H:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Rat (Rattus norvegicus)}
hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
wfnvynkvhitlsthecaglserdinlasfieqvavsmt

SCOP Domain Coordinates for d1dchh_:

Click to download the PDB-style file with coordinates for d1dchh_.
(The format of our PDB-style files is described here.)

Timeline for d1dchh_: