Lineage for d1dchg_ (1dch G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564741Superfamily d.74.1: PCD-like [55248] (2 families) (S)
    has additional alpha helix at the N-terminus
  5. 2564742Family d.74.1.1: PCD-like [55249] (3 proteins)
    Pfam PF01329
  6. 2564747Protein Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55250] (2 species)
  7. 2564748Species Norway rat (Rattus norvegicus) [TaxId:10116] [55251] (4 PDB entries)
  8. 2564775Domain d1dchg_: 1dch G: [39698]
    complexed with so4

Details for d1dchg_

PDB Entry: 1dch (more details), 3 Å

PDB Description: crystal structure of dcoh, a bifunctional, protein-binding transcription coactivator
PDB Compounds: (G:) dcoh (dimerization cofactor of hnf-1)

SCOPe Domain Sequences for d1dchg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dchg_ d.74.1.1 (G:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
wfnvynkvhitlsthecaglserdinlasfieqvavsmt

SCOPe Domain Coordinates for d1dchg_:

Click to download the PDB-style file with coordinates for d1dchg_.
(The format of our PDB-style files is described here.)

Timeline for d1dchg_: