Lineage for d7dm2l1 (7dm2 L:5-112)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367154Domain d7dm2l1: 7dm2 L:5-112 [396969]
    Other proteins in same PDB: d7dm2a_, d7dm2l2
    automated match to d8faba1
    complexed with po4

Details for d7dm2l1

PDB Entry: 7dm2 (more details), 2.4 Å

PDB Description: crystal structure of the m. tuberculosis phosphate abc transport receptor psts-1 in complex with fab p4-170
PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d7dm2l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dm2l1 b.1.1.0 (L:5-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqtpsasgtpgqrvtiscsgsrsnigsnyvywfqqfpgaapqlliyrniqrpsgvpa
rfsgsksdtsaslaisglrsedeahyycaawddslsgvvfgggtkvtv

SCOPe Domain Coordinates for d7dm2l1:

Click to download the PDB-style file with coordinates for d7dm2l1.
(The format of our PDB-style files is described here.)

Timeline for d7dm2l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7dm2l2
View in 3D
Domains from other chains:
(mouse over for more information)
d7dm2a_