Lineage for d7cogb_ (7cog B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900958Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. 2901042Protein automated matches [190277] (12 species)
    not a true protein
  7. 2901061Species Burkholderia stabilis [TaxId:95485] [396908] (2 PDB entries)
  8. 2901064Domain d7cogb_: 7cog B: [396965]
    automated match to d3lipa_
    complexed with ca

Details for d7cogb_

PDB Entry: 7cog (more details), 2.1 Å

PDB Description: cholesterol esterase from burkholderia stabilis (monoclinic crystal form)
PDB Compounds: (B:) Alpha/beta hydrolase

SCOPe Domain Sequences for d7cogb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cogb_ c.69.1.18 (B:) automated matches {Burkholderia stabilis [TaxId: 95485]}
addyattrypivlvhgltgtdkyagvleywygiqedlqqhgatvyvanlsgfqsddgpng
rgeqllayvktvlaatgatkvnlvghsqggltsryvaavapdlvasvttigtphrgsefa
dfvqgvlaydptglsssviaafvnvfgiltssshntnqdalaslktlttaqaatynqnyp
saglgapgscqtgaptetvggnthllyswagtaiqptlsvfgvtgatdtstiplvdpana
ldpstlalfgtgtvminrgsgqndglvskcsalygqvlstsykwnhideinqllgvrgaf
aedpvavirthanrlklagv

SCOPe Domain Coordinates for d7cogb_:

Click to download the PDB-style file with coordinates for d7cogb_.
(The format of our PDB-style files is described here.)

Timeline for d7cogb_: