Lineage for d7depb_ (7dep B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790667Species Staphylococcus aureus [TaxId:681288] [356122] (3 PDB entries)
  8. 2790671Domain d7depb_: 7dep B: [396958]
    automated match to d2vw9a_
    complexed with urf

Details for d7depb_

PDB Entry: 7dep (more details), 3.09 Å

PDB Description: s. aureus ssbb with 5-fu
PDB Compounds: (B:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d7depb_:

Sequence, based on SEQRES records: (download)

>d7depb_ b.40.4.0 (B:) automated matches {Staphylococcus aureus [TaxId: 681288]}
mlnrvvlvgrltkdpelrstpngvnvgtftlavnrtftnaqgereadfinvvvfkkqaen
vknylskgslagvdgrlqtrnyenkdgqrvfvtevvadsvqflepk

Sequence, based on observed residues (ATOM records): (download)

>d7depb_ b.40.4.0 (B:) automated matches {Staphylococcus aureus [TaxId: 681288]}
mlnrvvlvgrltkdpelrstpngvnvgtftlavnrtftnaqgereadfinvvvfkkqaen
vknylskgslagvdgrlqtrnyenrvfvtevvadsvqflepk

SCOPe Domain Coordinates for d7depb_:

Click to download the PDB-style file with coordinates for d7depb_.
(The format of our PDB-style files is described here.)

Timeline for d7depb_: