SCOPe 2.08: Domain d7dfog1: 7dfo G:1-190

Lineage for d7dfog1 (7dfo G:1-190)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (18 species)
   not a true protein

7. Species Streptomyces olivaceoviridis [TaxId:1921] [396913] (3 PDB entries)

8. Domain d7dfog1: 7dfo G:1-190 [396920]
   Other proteins in same PDB: d7dfoa2, d7dfob2, d7dfoc2, d7dfod2, d7dfoe2, d7dfof2, d7dfog2, d7dfoh2, d7dfoi2
   automated match to d5ej3a_
   complexed with cl, gcv, na, xyp

Details for d7dfog1

PDB Entry: 7dfo, 2 Å

PDB Description: crystal structure of glycoside hydrolase family 11 beta-xylanase from streptomyces olivaceoviridis e-86 in complex with 4-o-methyl-alpha-d- glucuronopyranosyl xylotetraose

PDB Compounds: (G:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d7dfog1:

Sequence; same for both SEQRES and ATOM records:

>d7dfog1 b.29.1.11 (G:1-190) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
atvittnqtgtnngfyysfwtdgggsvsmtlnsggnystswtncgnfvagkgwsnggrrn
vqysgsfypsgngylalygwtsnplveyyivdnwgnyrptgtykgtvtsdggtydvyqtt
rynapsvegtktfnqywsvrqskrtggtittgnhfdawarygmqlgsfsyymilategyq
ssgssnltvs

Timeline for d7dfog1:

• d7dfog1 first appeared in SCOPe 2.07