SCOPe 2.07: Domain d7cv2a1: 7cv2 A:7-70

Lineage for d7cv2a1 (7cv2 A:7-70)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [377691] (4 PDB entries)

8. Domain d7cv2a1: 7cv2 A:7-70 [396918]
   Other proteins in same PDB: d7cv2a2
   automated match to d1j5ya1
   complexed with nio, zn

Details for d7cv2a1

PDB Entry: 7cv2, 1.8 Å

PDB Description: crystal structure of b. halodurans niar in niacin-bound form

PDB Compounds: (A:) Transcriptional regulator NiaR

SCOPe Domain Sequences for d7cv2a1:

Sequence; same for both SEQRES and ATOM records:

>d7cv2a1 a.4.5.0 (A:7-70) automated matches {Bacillus halodurans [TaxId: 272558]}
ilgeerrsllikwlkasdtpltgaelakrtnvsrqvivqdvsllkaknhpilataqgyiy
mkea

Timeline for d7cv2a1:

• d7cv2a1 is new in SCOPe 2.07-stable
  
• d7cv2a1 appears in the current release, SCOPe 2.08