SCOPe 2.07: Domain d1f93d_: 1f93 D:

Lineage for d1f93d_ (1f93 D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.1: PCD-like [55248] (2 families)
   has additional alpha helix at the N-terminus

5. Family d.74.1.1: PCD-like [55249] (3 proteins)
   Pfam PF01329

6. Protein Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55250] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [55251] (4 PDB entries)

8. Domain d1f93d_: 1f93 D: [39691]
   Other proteins in same PDB: d1f93e_, d1f93f_, d1f93g_, d1f93h_

Details for d1f93d_

PDB Entry: 1f93, 2.6 Å

PDB Description: crystal structure of a complex between the dimerization domain of hnf-1 alpha and the coactivator dcoh

PDB Compounds: (D:) dimerization cofactor of hepatocyte nuclear factor 1-alpha

SCOPe Domain Sequences for d1f93d_:

Sequence; same for both SEQRES and ATOM records:

>d1f93d_ d.74.1.1 (D:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhp
ewfnvynkvhitlsthecaglserdinlasfieqvavsmt

Timeline for d1f93d_:

• d1f93d_ first appeared (with stable ids) in SCOP 1.55
  
• d1f93d_ appears in SCOPe 2.06
  
• d1f93d_ appears in the current release, SCOPe 2.08