Lineage for d1f93d_ (1f93 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564741Superfamily d.74.1: PCD-like [55248] (2 families) (S)
    has additional alpha helix at the N-terminus
  5. 2564742Family d.74.1.1: PCD-like [55249] (3 proteins)
    Pfam PF01329
  6. 2564747Protein Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55250] (2 species)
  7. 2564748Species Norway rat (Rattus norvegicus) [TaxId:10116] [55251] (4 PDB entries)
  8. 2564768Domain d1f93d_: 1f93 D: [39691]
    Other proteins in same PDB: d1f93e_, d1f93f_, d1f93g_, d1f93h_

Details for d1f93d_

PDB Entry: 1f93 (more details), 2.6 Å

PDB Description: crystal structure of a complex between the dimerization domain of hnf-1 alpha and the coactivator dcoh
PDB Compounds: (D:) dimerization cofactor of hepatocyte nuclear factor 1-alpha

SCOPe Domain Sequences for d1f93d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f93d_ d.74.1.1 (D:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhp
ewfnvynkvhitlsthecaglserdinlasfieqvavsmt

SCOPe Domain Coordinates for d1f93d_:

Click to download the PDB-style file with coordinates for d1f93d_.
(The format of our PDB-style files is described here.)

Timeline for d1f93d_: