SCOPe 2.07: Domain d7cv0a2: 7cv0 A:71-179

Lineage for d7cv0a2 (7cv0 A:71-179)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.2: Putative transcriptional regulator TM1602, C-terminal domain [75500] (2 families)
   automatically mapped to Pfam PF02829

5. Family d.94.2.0: automated matches [396903] (1 protein)
   not a true family

6. Protein automated matches [396904] (1 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [396905] (2 PDB entries)

8. Domain d7cv0a2: 7cv0 A:71-179 [396906]
   Other proteins in same PDB: d7cv0a1
   automated match to d1j5ya2
   complexed with zn

Details for d7cv0a2

PDB Entry: 7cv0, 2 Å

PDB Description: crystal structure of b. halodurans niar in apo form

PDB Compounds: (A:) Transcriptional regulator NiaR

SCOPe Domain Sequences for d7cv0a2:

Sequence; same for both SEQRES and ATOM records:

>d7cv0a2 d.94.2.0 (A:71-179) automated matches {Bacillus halodurans [TaxId: 272558]}
ntvqaqrvvacqhgpadmkdelltlvdhgvlikdvtvdhpvygditaslhlksrkdvalf
ckrmeesngtllstltkgvhmhtleaeseaildeairaleekgyllnsf

Timeline for d7cv0a2:

• d7cv0a2 is new in SCOPe 2.07-stable
  
• d7cv0a2 appears in the current release, SCOPe 2.08