Lineage for d1f93b_ (1f93 B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33483Fold d.74: DCoH-like [55247] (4 superfamilies)
  4. 33484Superfamily d.74.1: Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55248] (1 family) (S)
  5. 33485Family d.74.1.1: Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55249] (1 protein)
  6. 33486Protein Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55250] (1 species)
  7. 33487Species Rat (Rattus norvegicus) [TaxId:10116] [55251] (4 PDB entries)
  8. 33505Domain d1f93b_: 1f93 B: [39689]
    Other proteins in same PDB: d1f93e_, d1f93f_, d1f93g_, d1f93h_

Details for d1f93b_

PDB Entry: 1f93 (more details), 2.6 Å

PDB Description: crystal structure of a complex between the dimerization domain of hnf-1 alpha and the coactivator dcoh

SCOP Domain Sequences for d1f93b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f93b_ d.74.1.1 (B:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Rat (Rattus norvegicus)}
ahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhp
ewfnvynkvhitlsthecaglserdinlasfieqvavsm

SCOP Domain Coordinates for d1f93b_:

Click to download the PDB-style file with coordinates for d1f93b_.
(The format of our PDB-style files is described here.)

Timeline for d1f93b_: