![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.74: DCoH-like [55247] (4 superfamilies) |
![]() | Superfamily d.74.1: Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55248] (1 family) ![]() |
![]() | Family d.74.1.1: Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55249] (1 protein) |
![]() | Protein Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55250] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [55251] (4 PDB entries) |
![]() | Domain d1dcod_: 1dco D: [39683] |
PDB Entry: 1dco (more details), 2.3 Å
SCOP Domain Sequences for d1dcod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcod_ d.74.1.1 (D:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Rat (Rattus norvegicus)} hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe wfnvynkvhitlsthecaglserdinlasfieqvavsmt
Timeline for d1dcod_: