Lineage for d1dcob_ (1dco B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.74: DCoH-like [55247] (4 superfamilies) 
Superfamily d.74.1: Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55248] (1 family) 
Family d.74.1.1: Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55249] (1 protein) Protein Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55250] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [55251] (4 PDB entries) 
Domain d1dcob_: 1dco B: [39681]
Details for d1dcob_
PDB Entry: 1dco (more details), 2.3 Å
PDB Description: dcoh, a bifunctional protein-binding transcriptional coactivator
SCOP Domain Sequences for d1dcob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcob_ d.74.1.1 (B:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Rat (Rattus norvegicus)}
hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
wfnvynkvhitlsthecaglserdinlasfieqvavsmt
SCOP Domain Coordinates for d1dcob_:
Click to download the PDB-style file with coordinates for d1dcob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dcob_:
- d1dcob_ appears in SCOP 1.57
- d1dcob_ appears in the current release, SCOPe 2.08
View in 3D
