SCOPe 2.08: Domain d7a5qa_: 7a5q A:

Lineage for d7a5qa_ (7a5q A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [328970] (4 PDB entries)

8. Domain d7a5qa_: 7a5q A: [396806]
   automated match to d5ltca_
   complexed with bgc, gol, pge, slb

Details for d7a5qa_

PDB Entry: 7a5q, 1.68 Å

PDB Description: crystal structure of vcsiap bound to sialic acid

PDB Compounds: (A:) DctP family TRAP transporter solute-binding subunit

SCOPe Domain Sequences for d7a5qa_:

Sequence; same for both SEQRES and ATOM records:

>d7a5qa_ c.94.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
attlkmgmqasvgsveynsakmladtleemsqgeiklalypsaqlgddramlqqltlgdl
dityaefgrmglwipraeavmlpyvakdfdhlrrmfesdfgqgvrdemlqkfnwraldtw
yngtrettsnrplnsiedfkglklrvpnakqnlnyaklsgasptpmsfsevylalqtnav
dgqenplptiktmkfyevqknlamthhivndqmviisestwqklsdtdkdiiqkavqkvg
dahtqtvktqeaelvsffkseginvtypdlepfreamqplykefdsnigqpivsklaam

Timeline for d7a5qa_:

• d7a5qa_ first appeared in SCOPe 2.07