| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (161 species) not a true protein |
| Species Vibrio cholerae [TaxId:666] [328970] (4 PDB entries) |
| Domain d7a5qa_: 7a5q A: [396806] automated match to d5ltca_ complexed with bgc, gol, pge, slb |
PDB Entry: 7a5q (more details), 1.68 Å
SCOPe Domain Sequences for d7a5qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a5qa_ c.94.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
attlkmgmqasvgsveynsakmladtleemsqgeiklalypsaqlgddramlqqltlgdl
dityaefgrmglwipraeavmlpyvakdfdhlrrmfesdfgqgvrdemlqkfnwraldtw
yngtrettsnrplnsiedfkglklrvpnakqnlnyaklsgasptpmsfsevylalqtnav
dgqenplptiktmkfyevqknlamthhivndqmviisestwqklsdtdkdiiqkavqkvg
dahtqtvktqeaelvsffkseginvtypdlepfreamqplykefdsnigqpivsklaam
Timeline for d7a5qa_: