Lineage for d1dcph_ (1dcp H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958013Superfamily d.74.1: PCD-like [55248] (2 families) (S)
    has additional alpha helix at the N-terminus
  5. 2958014Family d.74.1.1: PCD-like [55249] (3 proteins)
    Pfam PF01329
  6. 2958019Protein Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55250] (2 species)
  7. 2958020Species Norway rat (Rattus norvegicus) [TaxId:10116] [55251] (4 PDB entries)
  8. 2958028Domain d1dcph_: 1dcp H: [39679]
    complexed with hbi

Details for d1dcph_

PDB Entry: 1dcp (more details), 2.3 Å

PDB Description: dcoh, a bifunctional protein-binding transcriptional coactivator, complexed with biopterin
PDB Compounds: (H:) dcoh

SCOPe Domain Sequences for d1dcph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcph_ d.74.1.1 (H:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
wfnvynkvhitlsthecaglserdinlasfieqvavsmt

SCOPe Domain Coordinates for d1dcph_:

Click to download the PDB-style file with coordinates for d1dcph_.
(The format of our PDB-style files is described here.)

Timeline for d1dcph_: