SCOPe 2.07: Domain d6zidm_: 6zid M:

Lineage for d6zidm_ (6zid M:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (4 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81478] (21 PDB entries)

8. Domain d6zidm_: 6zid M: [396735]
   Other proteins in same PDB: d6zidc_, d6zidh1, d6zidh2, d6zidl_
   automated match to d6prcm_
   complexed with bcb, bpb, dga, fe, hec, hto, lda, mq7, ns5, so4

Details for d6zidm_

PDB Entry: 6zid, 2.8 Å

PDB Description: ultrafast structural response to charge redistribution within a photosynthetic reaction centre - 5 ps (b) structure

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d6zidm_:

Sequence; same for both SEQRES and ATOM records:

>d6zidm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d6zidm_:

• d6zidm_ is new in SCOPe 2.07-stable
  
• d6zidm_ appears in the current release, SCOPe 2.08