Lineage for d1rscm_ (1rsc M:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33418Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
  4. 33419Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 33420Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 33421Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species)
  7. 33470Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [55246] (2 PDB entries)
  8. 33472Domain d1rscm_: 1rsc M: [39671]
    Other proteins in same PDB: d1rsca1, d1rsca2

Details for d1rscm_

PDB Entry: 1rsc (more details), 2.3 Å

PDB Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate

SCOP Domain Sequences for d1rscm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rscm_ d.73.1.1 (M:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301}
smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr

SCOP Domain Coordinates for d1rscm_:

Click to download the PDB-style file with coordinates for d1rscm_.
(The format of our PDB-style files is described here.)

Timeline for d1rscm_: