Lineage for d1rblm_ (1rbl M:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605700Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 605701Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 605702Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 605703Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (7 species)
  7. 605784Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [55246] (2 PDB entries)
  8. 605785Domain d1rblm_: 1rbl M: [39670]
    Other proteins in same PDB: d1rbla1, d1rbla2
    complexed with cap, cbx, mg

Details for d1rblm_

PDB Entry: 1rbl (more details), 2.2 Å

PDB Description: structure determination and refinement of ribulose 1,5 bisphosphate carboxylase(slash)oxygenase from synechococcus pcc6301

SCOP Domain Sequences for d1rblm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rblm_ d.73.1.1 (M:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301}
smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr

SCOP Domain Coordinates for d1rblm_:

Click to download the PDB-style file with coordinates for d1rblm_.
(The format of our PDB-style files is described here.)

Timeline for d1rblm_: