![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
![]() | Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (7 species) |
![]() | Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [55246] (2 PDB entries) |
![]() | Domain d1rblm_: 1rbl M: [39670] Other proteins in same PDB: d1rbla1, d1rbla2 complexed with cap, cbx, mg |
PDB Entry: 1rbl (more details), 2.2 Å
SCOP Domain Sequences for d1rblm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rblm_ d.73.1.1 (M:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301} smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr
Timeline for d1rblm_: