Lineage for d1rblm_ (1rbl M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957672Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2957807Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [55246] (2 PDB entries)
  8. 2957812Domain d1rblm_: 1rbl M: [39670]
    Other proteins in same PDB: d1rbla1, d1rbla2, d1rblb1, d1rblb2, d1rblc1, d1rblc2, d1rbld1, d1rbld2, d1rble1, d1rble2, d1rblf1, d1rblf2, d1rblg1, d1rblg2, d1rblh1, d1rblh2
    complexed with cap, fmt, mg

Details for d1rblm_

PDB Entry: 1rbl (more details), 2.2 Å

PDB Description: structure determination and refinement of ribulose 1,5 bisphosphate carboxylase(slash)oxygenase from synechococcus pcc6301
PDB Compounds: (M:) ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)

SCOPe Domain Sequences for d1rblm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rblm_ d.73.1.1 (M:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr

SCOPe Domain Coordinates for d1rblm_:

Click to download the PDB-style file with coordinates for d1rblm_.
(The format of our PDB-style files is described here.)

Timeline for d1rblm_: