SCOPe 2.07: Domain d6zi6h2: 6zi6 H:37-258

Lineage for d6zi6h2 (6zi6 H:37-258)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [50349] (26 PDB entries)

8. Domain d6zi6h2: 6zi6 H:37-258 [396698]
   Other proteins in same PDB: d6zi6c_, d6zi6h1, d6zi6l_, d6zi6m_
   automated match to d1r2ch1
   complexed with bcb, bpb, dga, fe, hec, hto, lda, mq7, ns5, so4

Details for d6zi6h2

PDB Entry: 6zi6, 2.8 Å

PDB Description: ultrafast structural response to charge redistribution within a photosynthetic reaction centre - 20 ps structure

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d6zi6h2:

Sequence; same for both SEQRES and ATOM records:

>d6zi6h2 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

Timeline for d6zi6h2:

• d6zi6h2 is new in SCOPe 2.07-stable
  
• d6zi6h2 appears in the current release, SCOPe 2.08