Lineage for d6zi6h2 (6zi6 H:37-258)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791427Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2791428Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2791429Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2791430Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2791529Species Rhodopseudomonas viridis [TaxId:1079] [50349] (26 PDB entries)
  8. 2791552Domain d6zi6h2: 6zi6 H:37-258 [396698]
    Other proteins in same PDB: d6zi6c_, d6zi6h1, d6zi6l_, d6zi6m_
    automated match to d1r2ch1
    complexed with bcb, bpb, dga, fe, hec, hto, lda, mq7, ns5, so4

Details for d6zi6h2

PDB Entry: 6zi6 (more details), 2.8 Å

PDB Description: ultrafast structural response to charge redistribution within a photosynthetic reaction centre - 20 ps structure
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d6zi6h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zi6h2 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOPe Domain Coordinates for d6zi6h2:

Click to download the PDB-style file with coordinates for d6zi6h2.
(The format of our PDB-style files is described here.)

Timeline for d6zi6h2: