Lineage for d1bxnk_ (1bxn K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957672Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2957673Species Alcaligenes eutrophus [TaxId:106590] [55245] (1 PDB entry)
  8. 2957676Domain d1bxnk_: 1bxn K: [39668]
    Other proteins in same PDB: d1bxna1, d1bxna2, d1bxnc1, d1bxnc2, d1bxne1, d1bxne2, d1bxng1, d1bxng2
    complexed with po4

Details for d1bxnk_

PDB Entry: 1bxn (more details), 2.7 Å

PDB Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.
PDB Compounds: (K:) protein (ribulose bisphosphate carboxylase small chain)

SCOPe Domain Sequences for d1bxnk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxnk_ d.73.1.1 (K:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus [TaxId: 106590]}
mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
lrysiesya

SCOPe Domain Coordinates for d1bxnk_:

Click to download the PDB-style file with coordinates for d1bxnk_.
(The format of our PDB-style files is described here.)

Timeline for d1bxnk_: