Lineage for d6z9jb_ (6z9j B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835078Species Escherichia coli [TaxId:562] [189174] (10 PDB entries)
  8. 2835083Domain d6z9jb_: 6z9j B: [396676]
    automated match to d1p1xa_
    complexed with mg; mutant

Details for d6z9jb_

PDB Entry: 6z9j (more details), 1.5 Å

PDB Description: escherichia coli d-2-deoxyribose-5-phosphate aldolase - n21k mutant
PDB Compounds: (B:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d6z9jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z9jb_ c.1.10.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
tdlkasslralklmdlttlkdddtdekvialchqaktpvgntaaiciyprfipiarktlk
eqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfdl
vkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpes
arimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgassll
asllkalgh

SCOPe Domain Coordinates for d6z9jb_:

Click to download the PDB-style file with coordinates for d6z9jb_.
(The format of our PDB-style files is described here.)

Timeline for d6z9jb_: