Lineage for d6z9ja_ (6z9j A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2443025Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2443602Protein automated matches [190095] (28 species)
    not a true protein
  7. 2443701Species Escherichia coli [TaxId:562] [189174] (10 PDB entries)
  8. 2443709Domain d6z9ja_: 6z9j A: [396671]
    automated match to d1p1xa_
    complexed with mg; mutant

Details for d6z9ja_

PDB Entry: 6z9j (more details), 1.5 Å

PDB Description: escherichia coli d-2-deoxyribose-5-phosphate aldolase - n21k mutant
PDB Compounds: (A:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d6z9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z9ja_ c.1.10.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
mtdlkasslralklmdlttlkdddtdekvialchqaktpvgntaaiciyprfipiarktl
keqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfd
lvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpe
sarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgassl
lasllkalgh

SCOPe Domain Coordinates for d6z9ja_:

Click to download the PDB-style file with coordinates for d6z9ja_.
(The format of our PDB-style files is described here.)

Timeline for d6z9ja_: