Lineage for d1bxnj_ (1bxn J:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200260Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2200261Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2200262Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2200263Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 2200264Species Alcaligenes eutrophus [TaxId:106590] [55245] (1 PDB entry)
  8. 2200266Domain d1bxnj_: 1bxn J: [39667]
    Other proteins in same PDB: d1bxna1, d1bxna2, d1bxnc1, d1bxnc2, d1bxne1, d1bxne2, d1bxng1, d1bxng2
    complexed with po4

Details for d1bxnj_

PDB Entry: 1bxn (more details), 2.7 Å

PDB Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.
PDB Compounds: (J:) protein (ribulose bisphosphate carboxylase small chain)

SCOPe Domain Sequences for d1bxnj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxnj_ d.73.1.1 (J:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus [TaxId: 106590]}
mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
lrysiesya

SCOPe Domain Coordinates for d1bxnj_:

Click to download the PDB-style file with coordinates for d1bxnj_.
(The format of our PDB-style files is described here.)

Timeline for d1bxnj_: