SCOP 1.71: Domain d1bxnj_: 1bxn J:

Lineage for d1bxnj_ (1bxn J:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (7 species)

7. Species Alcaligenes eutrophus [TaxId:106590] [55245] (1 PDB entry)

8. Domain d1bxnj_: 1bxn J: [39667]
   Other proteins in same PDB: d1bxna1, d1bxna2, d1bxnc1, d1bxnc2, d1bxne1, d1bxne2, d1bxng1, d1bxng2

Details for d1bxnj_

PDB Entry: 1bxn, 2.7 Å

PDB Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.

SCOP Domain Sequences for d1bxnj_:

Sequence; same for both SEQRES and ATOM records:

>d1bxnj_ d.73.1.1 (J:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus}
mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
lrysiesya

Timeline for d1bxnj_:

• d1bxnj_ first appeared (with stable ids) in SCOP 1.55
  
• d1bxnj_ appears in SCOP 1.69
  
• d1bxnj_ appears in SCOP 1.73
  
• d1bxnj_ appears in the current release, SCOPe 2.08