Lineage for d1bxni_ (1bxn I:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1208801Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1208802Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1208803Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1208804Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 1208805Species Alcaligenes eutrophus [TaxId:106590] [55245] (1 PDB entry)
  8. 1208806Domain d1bxni_: 1bxn I: [39666]
    Other proteins in same PDB: d1bxna1, d1bxna2, d1bxnc1, d1bxnc2, d1bxne1, d1bxne2, d1bxng1, d1bxng2
    complexed with po4

Details for d1bxni_

PDB Entry: 1bxn (more details), 2.7 Å

PDB Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.
PDB Compounds: (I:) protein (ribulose bisphosphate carboxylase small chain)

SCOPe Domain Sequences for d1bxni_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxni_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus [TaxId: 106590]}
mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
lrysiesya

SCOPe Domain Coordinates for d1bxni_:

Click to download the PDB-style file with coordinates for d1bxni_.
(The format of our PDB-style files is described here.)

Timeline for d1bxni_: