Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Horse (Equus caballus) [TaxId:9796] [396656] (2 PDB entries) |
Domain d6zj9a1: 6zj9 A:3-80 [396657] Other proteins in same PDB: d6zj9a2 automated match to d1gsea2 complexed with edo, gsh |
PDB Entry: 6zj9 (more details), 2.2 Å
SCOPe Domain Sequences for d6zj9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zj9a1 c.47.1.0 (A:3-80) automated matches {Horse (Equus caballus) [TaxId: 9796]} vkpmlhyfngrgrmepirwllaaagvefeetfidtpedfeklkndgslmfqqvpmveidg mklvqsrailnyvaakhn
Timeline for d6zj9a1: