Lineage for d1bwvu_ (1bwv U:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 330444Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 330445Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 330446Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 330447Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 330474Species Galdieria partita [TaxId:83374] [55244] (2 PDB entries)
  8. 330476Domain d1bwvu_: 1bwv U: [39663]
    Other proteins in same PDB: d1bwva1, d1bwva2, d1bwvc1, d1bwvc2, d1bwve1, d1bwve2, d1bwvg1, d1bwvg2

Details for d1bwvu_

PDB Entry: 1bwv (more details), 2.4 Å

PDB Description: Activated Ribulose 1,5-Bisphosphate Carboxylase/Oxygenase (RUBISCO) Complexed with the Reaction Intermediate Analogue 2-Carboxyarabinitol 1,5-Bisphosphate

SCOP Domain Sequences for d1bwvu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwvu_ d.73.1.1 (U:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita}
vritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
ikytihsyesykpedery

SCOP Domain Coordinates for d1bwvu_:

Click to download the PDB-style file with coordinates for d1bwvu_.
(The format of our PDB-style files is described here.)

Timeline for d1bwvu_: