Lineage for d1bwvs_ (1bwv S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957672Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2957678Species Galdieria partita [TaxId:83374] [55244] (2 PDB entries)
  8. 2957679Domain d1bwvs_: 1bwv S: [39662]
    Other proteins in same PDB: d1bwva1, d1bwva2, d1bwvc1, d1bwvc2, d1bwve1, d1bwve2, d1bwvg1, d1bwvg2
    complexed with cap, mg

Details for d1bwvs_

PDB Entry: 1bwv (more details), 2.4 Å

PDB Description: Activated Ribulose 1,5-Bisphosphate Carboxylase/Oxygenase (RUBISCO) Complexed with the Reaction Intermediate Analogue 2-Carboxyarabinitol 1,5-Bisphosphate
PDB Compounds: (S:) protein (ribulose bisphosphate carboxylase)

SCOPe Domain Sequences for d1bwvs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwvs_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]}
vritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
ikytihsyesykpedery

SCOPe Domain Coordinates for d1bwvs_:

Click to download the PDB-style file with coordinates for d1bwvs_.
(The format of our PDB-style files is described here.)

Timeline for d1bwvs_: