Lineage for d6z1jl_ (6z1j L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027283Protein L (light) subunit [81477] (4 species)
  7. 3027284Species Rhodobacter sphaeroides [TaxId:1063] [81475] (68 PDB entries)
    Uniprot P02954
  8. 3027289Domain d6z1jl_: 6z1j L: [396579]
    Other proteins in same PDB: d6z1jh1, d6z1jh2, d6z1jm_
    automated match to d3v3yl_
    complexed with bcl, bph, fe, lda, nkp, olc, po4, spn, u10, unl

Details for d6z1jl_

PDB Entry: 6z1j (more details), 2.1 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides strain rv lsp co-crystallization with spheroidene
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d6z1jl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z1jl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaitff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d6z1jl_:

Click to download the PDB-style file with coordinates for d6z1jl_.
(The format of our PDB-style files is described here.)

Timeline for d6z1jl_: