SCOPe 2.08: Domain d6z80q_: 6z80 Q:

Lineage for d6z80q_ (6z80 Q:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165

4. Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family)
   automatically mapped to Pfam PF06399

5. Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (2 proteins)

6. Protein automated matches [394245] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [394246] (7 PDB entries)

8. Domain d6z80q_: 6z80 Q: [396578]
   Other proteins in same PDB: d6z80a_, d6z80b_, d6z80c_, d6z80d_, d6z80e_, d6z80f_, d6z80g_, d6z80h_, d6z80i_, d6z80j_
   automated match to d1wplk_
   complexed with 8gt, phe, zn

Details for d6z80q_

PDB Entry: 6z80, 3 Å

PDB Description: stimulatory human gtp cyclohydrolase i - gfrp complex

PDB Compounds: (Q:) GTP cyclohydrolase 1 feedback regulatory protein

SCOPe Domain Sequences for d6z80q_:

Sequence; same for both SEQRES and ATOM records:

>d6z80q_ d.205.1.1 (Q:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpyllistqirmevgptmvgdeqsdpelmqhlgaskrralgnnfyeyyvddpprivldkl
errgfrvlsmtgvgqtlvwclhk

Timeline for d6z80q_:

• d6z80q_ first appeared in SCOPe 2.07