Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (4 families) |
Family b.40.6.0: automated matches [254223] (1 protein) not a true family |
Protein automated matches [254506] (3 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [396514] (1 PDB entry) |
Domain d6yira3: 6yir A:296-365 [396516] Other proteins in same PDB: d6yira1, d6yira4 automated match to d2d62a3 complexed with pge, so4 |
PDB Entry: 6yir (more details), 1.68 Å
SCOPe Domain Sequences for d6yira3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yira3 b.40.6.0 (A:296-365) automated matches {Bacillus subtilis [TaxId: 224308]} esyknssikakinvaellgseimiysqidnqdfiaridarldiqsgdeltvafdmnkghf fdsetevrir
Timeline for d6yira3: