Lineage for d6yira3 (6yir A:296-365)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2400579Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2400731Family b.40.6.0: automated matches [254223] (1 protein)
    not a true family
  6. 2400732Protein automated matches [254506] (3 species)
    not a true protein
  7. 2400733Species Bacillus subtilis [TaxId:224308] [396514] (1 PDB entry)
  8. 2400735Domain d6yira3: 6yir A:296-365 [396516]
    Other proteins in same PDB: d6yira1, d6yira4
    automated match to d2d62a3
    complexed with pge, so4

Details for d6yira3

PDB Entry: 6yir (more details), 1.68 Å

PDB Description: crystal structure of bacillus subtilis msmx atpase
PDB Compounds: (A:) Oligosaccharides import ATP-binding protein MsmX

SCOPe Domain Sequences for d6yira3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yira3 b.40.6.0 (A:296-365) automated matches {Bacillus subtilis [TaxId: 224308]}
esyknssikakinvaellgseimiysqidnqdfiaridarldiqsgdeltvafdmnkghf
fdsetevrir

SCOPe Domain Coordinates for d6yira3:

Click to download the PDB-style file with coordinates for d6yira3.
(The format of our PDB-style files is described here.)

Timeline for d6yira3: