SCOP 1.75: Domain d1rcoc_: 1rco C:

Lineage for d1rcoc_ (1rco C:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)

8. Domain d1rcoc_: 1rco C: [39647]
   Other proteins in same PDB: d1rcob1, d1rcob2, d1rcoe1, d1rcoe2, d1rcoh1, d1rcoh2, d1rcok1, d1rcok2, d1rcol1, d1rcol2, d1rcoo1, d1rcoo2, d1rcor1, d1rcor2, d1rcov1, d1rcov2

Details for d1rcoc_

PDB Entry: 1rco, 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor d-xylulose-2,2-diol-1,5-bisphosphate

PDB Compounds: (C:) ribulose bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d1rcoc_:

Sequence; same for both SEQRES and ATOM records:

>d1rcoc_ d.73.1.1 (C:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

Timeline for d1rcoc_:

• d1rcoc_ first appeared (with stable ids) in SCOP 1.55
  
• d1rcoc_ appears in SCOP 1.73
  
• d1rcoc_ appears in SCOPe 2.01
  
• d1rcoc_ appears in the current release, SCOPe 2.08