Lineage for d6ycea_ (6yce A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927798Species Pineapple (Ananas comosus) [TaxId:4615] [358316] (10 PDB entries)
  8. 2927809Domain d6ycea_: 6yce A: [396461]
    automated match to d1iwda_
    complexed with ipa, nag

Details for d6ycea_

PDB Entry: 6yce (more details), 1.8 Å

PDB Description: structure the bromelain protease from ananas comosus with a thiomethylated active cysteine
PDB Compounds: (A:) fbsb

SCOPe Domain Sequences for d6ycea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ycea_ d.3.1.0 (A:) automated matches {Pineapple (Ananas comosus) [TaxId: 4615]}
vpqsidwrdygavtsvknqnpcgacwafaaiatvesiykikkgileplseqqvldcakgy
gckggwefrafefiisnkgvasgaiypykaakgtcktngvpnsayitgyarvprnnessm
myavskqpitvavdananfqyyksgvfngpcgtslnhavtaigygqdsngkkywivknsw
garwgeagyirmardvssssgicgiaidslyptle

SCOPe Domain Coordinates for d6ycea_:

Click to download the PDB-style file with coordinates for d6ycea_.
(The format of our PDB-style files is described here.)

Timeline for d6ycea_: