Lineage for d1rcos_ (1rco S:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33418Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
  4. 33419Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 33420Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 33421Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species)
  7. 33432Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)
  8. 33459Domain d1rcos_: 1rco S: [39646]
    Other proteins in same PDB: d1rcob1, d1rcob2, d1rcoe1, d1rcoe2, d1rcoh1, d1rcoh2, d1rcok1, d1rcok2, d1rcol1, d1rcol2, d1rcoo1, d1rcoo2, d1rcor1, d1rcor2, d1rcov1, d1rcov2

Details for d1rcos_

PDB Entry: 1rco (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor d-xylulose-2,2-diol-1,5-bisphosphate

SCOP Domain Sequences for d1rcos_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcos_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOP Domain Coordinates for d1rcos_:

Click to download the PDB-style file with coordinates for d1rcos_.
(The format of our PDB-style files is described here.)

Timeline for d1rcos_: