SCOP 1.73: Domain d1auss_: 1aus S:

Lineage for d1auss_ (1aus S:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)

8. Domain d1auss_: 1aus S: [39645]
   Other proteins in same PDB: d1ausl1, d1ausl2, d1ausm1, d1ausm2, d1ausn1, d1ausn2, d1auso1, d1auso2
   complexed with cbx, mg

Details for d1auss_

PDB Entry: 1aus, 2.2 Å

PDB Description: activated unliganded spinach rubisco

PDB Compounds: (S:) ribulose bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d1auss_:

Sequence; same for both SEQRES and ATOM records:

>d1auss_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

Timeline for d1auss_:

• d1auss_ first appeared (with stable ids) in SCOP 1.55
  
• d1auss_ appears in SCOP 1.71
  
• d1auss_ appears in SCOP 1.75
  
• d1auss_ appears in the current release, SCOPe 2.08