Lineage for d1rxoi_ (1rxo I:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) 
Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species) Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries) 
Domain d1rxoi_: 1rxo I: [39644]
Other proteins in same PDB: d1rxob1, d1rxob2, d1rxoe1, d1rxoe2, d1rxoh1, d1rxoh2, d1rxol1, d1rxol2
Details for d1rxoi_
PDB Entry: 1rxo (more details), 2.2 Å
PDB Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium
SCOP Domain Sequences for d1rxoi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxoi_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy
SCOP Domain Coordinates for d1rxoi_:
Click to download the PDB-style file with coordinates for d1rxoi_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rxoi_:
- d1rxoi_ appears in SCOP 1.57
- d1rxoi_ appears in the current release, SCOPe 2.08
View in 3D
