Lineage for d1rxof_ (1rxo F:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413835Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 413836Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 413837Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 413838Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 413878Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)
  8. 413897Domain d1rxof_: 1rxo F: [39643]
    Other proteins in same PDB: d1rxob1, d1rxob2, d1rxoe1, d1rxoe2, d1rxoh1, d1rxoh2, d1rxol1, d1rxol2

Details for d1rxof_

PDB Entry: 1rxo (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium

SCOP Domain Sequences for d1rxof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxof_ d.73.1.1 (F:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOP Domain Coordinates for d1rxof_:

Click to download the PDB-style file with coordinates for d1rxof_.
(The format of our PDB-style files is described here.)

Timeline for d1rxof_: