SCOP 1.73: Domain d1rxoc_: 1rxo C:

Lineage for d1rxoc_ (1rxo C:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)

8. Domain d1rxoc_: 1rxo C: [39642]
   Other proteins in same PDB: d1rxob1, d1rxob2, d1rxoe1, d1rxoe2, d1rxoh1, d1rxoh2, d1rxol1, d1rxol2

Details for d1rxoc_

PDB Entry: 1rxo, 2.2 Å

PDB Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium

PDB Compounds: (C:) ribulose bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d1rxoc_:

Sequence; same for both SEQRES and ATOM records:

>d1rxoc_ d.73.1.1 (C:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

Timeline for d1rxoc_:

• d1rxoc_ first appeared (with stable ids) in SCOP 1.55
  
• d1rxoc_ appears in SCOP 1.71
  
• d1rxoc_ appears in SCOP 1.75
  
• d1rxoc_ appears in the current release, SCOPe 2.08