| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species) |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries) |
| Domain d1rxos_: 1rxo S: [39641] Other proteins in same PDB: d1rxob1, d1rxob2, d1rxoe1, d1rxoe2, d1rxoh1, d1rxoh2, d1rxol1, d1rxol2 |
PDB Entry: 1rxo (more details), 2.2 Å
SCOP Domain Sequences for d1rxos_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxos_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy
Timeline for d1rxos_: