| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species) |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries) |
| Domain d1aa1i_: 1aa1 I: [39640] Other proteins in same PDB: d1aa1b1, d1aa1b2, d1aa1e1, d1aa1e2, d1aa1h1, d1aa1h2, d1aa1l1, d1aa1l2 complexed with 3pg, mg |
PDB Entry: 1aa1 (more details), 2.2 Å
SCOPe Domain Sequences for d1aa1i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aa1i_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy
Timeline for d1aa1i_: