Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries) |
Domain d1aa1i_: 1aa1 I: [39640] Other proteins in same PDB: d1aa1b1, d1aa1b2, d1aa1e1, d1aa1e2, d1aa1h1, d1aa1h2, d1aa1l1, d1aa1l2 |
PDB Entry: 1aa1 (more details), 2.2 Å
SCOP Domain Sequences for d1aa1i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aa1i_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)} mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp agy
Timeline for d1aa1i_: