SCOPe 2.08: Domain d6xp1e2: 6xp1 E:165-275

Lineage for d6xp1e2 (6xp1 E:165-275)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)

8. Domain d6xp1e2: 6xp1 E:165-275 [396396]
   Other proteins in same PDB: d6xp1a1, d6xp1b1, d6xp1b3, d6xp1c1, d6xp1d1, d6xp1d3, d6xp1e1, d6xp1e3
   automated match to d2izzc2
   complexed with so4, t2c

Details for d6xp1e2

PDB Entry: 6xp1, 1.75 Å

PDB Description: structure of human pycr1 complexed with l-thiazolidine-2-carboxylate

PDB Compounds: (E:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d6xp1e2:

Sequence; same for both SEQRES and ATOM records:

>d6xp1e2 a.100.1.0 (E:165-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqe

Timeline for d6xp1e2:

• d6xp1e2 first appeared in SCOPe 2.07