Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries) |
Domain d6xp1e1: 6xp1 E:1-164 [396395] Other proteins in same PDB: d6xp1a2, d6xp1b2, d6xp1b3, d6xp1c2, d6xp1d2, d6xp1d3, d6xp1e2, d6xp1e3 automated match to d2izza1 complexed with so4, t2c |
PDB Entry: 6xp1 (more details), 1.75 Å
SCOPe Domain Sequences for d6xp1e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xp1e1 c.2.1.0 (E:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]} msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee
Timeline for d6xp1e1: