SCOPe 2.08: Domain d6xp1e1: 6xp1 E:1-164

Lineage for d6xp1e1 (6xp1 E:1-164)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)

8. Domain d6xp1e1: 6xp1 E:1-164 [396395]
   Other proteins in same PDB: d6xp1a2, d6xp1b2, d6xp1b3, d6xp1c2, d6xp1d2, d6xp1d3, d6xp1e2, d6xp1e3
   automated match to d2izza1
   complexed with so4, t2c

Details for d6xp1e1

PDB Entry: 6xp1, 1.75 Å

PDB Description: structure of human pycr1 complexed with l-thiazolidine-2-carboxylate

PDB Compounds: (E:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d6xp1e1:

Sequence; same for both SEQRES and ATOM records:

>d6xp1e1 c.2.1.0 (E:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv
qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc
mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee

Timeline for d6xp1e1:

• d6xp1e1 first appeared in SCOPe 2.07