Lineage for d1aa1f_ (1aa1 F:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81179Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
  4. 81180Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 81181Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 81182Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species)
  7. 81193Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)
  8. 81207Domain d1aa1f_: 1aa1 F: [39639]
    Other proteins in same PDB: d1aa1b1, d1aa1b2, d1aa1e1, d1aa1e2, d1aa1h1, d1aa1h2, d1aa1l1, d1aa1l2

Details for d1aa1f_

PDB Entry: 1aa1 (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with the product 3-phosphoglycerate

SCOP Domain Sequences for d1aa1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa1f_ d.73.1.1 (F:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOP Domain Coordinates for d1aa1f_:

Click to download the PDB-style file with coordinates for d1aa1f_.
(The format of our PDB-style files is described here.)

Timeline for d1aa1f_: