Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries) |
Domain d6xp0b1: 6xp0 B:1-164 [396384] Other proteins in same PDB: d6xp0a2, d6xp0a3, d6xp0b2, d6xp0b3, d6xp0c2, d6xp0c3, d6xp0d2, d6xp0d3, d6xp0e2 automated match to d2izza1 complexed with fpk |
PDB Entry: 6xp0 (more details), 1.95 Å
SCOPe Domain Sequences for d6xp0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xp0b1 c.2.1.0 (B:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]} msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee
Timeline for d6xp0b1: