Lineage for d1aa1c_ (1aa1 C:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 330444Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 330445Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 330446Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 330447Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 330487Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)
  8. 330500Domain d1aa1c_: 1aa1 C: [39638]
    Other proteins in same PDB: d1aa1b1, d1aa1b2, d1aa1e1, d1aa1e2, d1aa1h1, d1aa1h2, d1aa1l1, d1aa1l2

Details for d1aa1c_

PDB Entry: 1aa1 (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with the product 3-phosphoglycerate

SCOP Domain Sequences for d1aa1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa1c_ d.73.1.1 (C:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOP Domain Coordinates for d1aa1c_:

Click to download the PDB-style file with coordinates for d1aa1c_.
(The format of our PDB-style files is described here.)

Timeline for d1aa1c_: