Lineage for d1aa1s_ (1aa1 S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957672Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2957754Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 2957766Domain d1aa1s_: 1aa1 S: [39637]
    Other proteins in same PDB: d1aa1b1, d1aa1b2, d1aa1e1, d1aa1e2, d1aa1h1, d1aa1h2, d1aa1l1, d1aa1l2
    complexed with 3pg, mg

Details for d1aa1s_

PDB Entry: 1aa1 (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with the product 3-phosphoglycerate
PDB Compounds: (S:) ribulose bisphosphate carboxylase (small chain)

SCOPe Domain Sequences for d1aa1s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa1s_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOPe Domain Coordinates for d1aa1s_:

Click to download the PDB-style file with coordinates for d1aa1s_.
(The format of our PDB-style files is described here.)

Timeline for d1aa1s_: