SCOP 1.73: Domain d1rboi_: 1rbo I:

Lineage for d1rboi_ (1rbo I:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)

8. Domain d1rboi_: 1rbo I: [39636]
   Other proteins in same PDB: d1rbob1, d1rbob2, d1rboe1, d1rboe2, d1rboh1, d1rboh2, d1rbol1, d1rbol2
   complexed with cap

Details for d1rboi_

PDB Entry: 1rbo, 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor 2-carboxyarabinitol-1,5- diphosphate

PDB Compounds: (I:) ribulose bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d1rboi_:

Sequence; same for both SEQRES and ATOM records:

>d1rboi_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

Timeline for d1rboi_:

• d1rboi_ first appeared (with stable ids) in SCOP 1.55
  
• d1rboi_ appears in SCOP 1.71
  
• d1rboi_ appears in SCOP 1.75
  
• d1rboi_ appears in the current release, SCOPe 2.08