Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries) |
Domain d1rbos_: 1rbo S: [39633] Other proteins in same PDB: d1rbob1, d1rbob2, d1rboe1, d1rboe2, d1rboh1, d1rboh2, d1rbol1, d1rbol2 |
PDB Entry: 1rbo (more details), 2.3 Å
SCOP Domain Sequences for d1rbos_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rbos_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)} mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp agy
Timeline for d1rbos_: